PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01495.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 138aa    MW: 15413.8 Da    PI: 11.1394
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01495.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.11.5e-1653101553
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                              +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk  l el+
  Rsa1.0_01495.1_g00006.1  53 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALGELE 101
                              79****************************************9999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1649113IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.64551103IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.63E-1253101No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-1553102No hitNo description
CDDcd147072.75E-2253107No hitNo description
PfamPF001709.8E-1553101IPR004827Basic-leucine zipper domain
PROSITE patternPS0003605671IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MAMVGPLSPV SSDGLGHGQV DNIGGGGQYG VEMGGLRGRK RVVDGPVEKV VERRQRRMIK  60
NRESAARSRA RKQAYTVELE AELNQLKEEN AQLKHALGEL ERKRKQQYFE SLKTRAQPKL  120
PKAIGRLRTL VRNPSCPL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX8706201e-142JX870620.1 Brassica oleracea var. capitata ABA insensitve 5-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141571.12e-86PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like
SwissprotQ9SJN06e-86ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLM4DL703e-86M4DL70_BRARP; Uncharacterized protein
STRINGBra017251.1-P8e-86(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3760022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.13e-78bZIP family protein